PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_03842.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 345aa    MW: 39035.1 Da    PI: 9.2834
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_03842.1_g00008.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.83.7e-52141391128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrF Ptdeel+v+yL+kkv+g++++l ++i e+d+yk++Pw Lp+k++ +ekewyfFs+rd+ky++g+r+nr++ +gyWkat
  Sme2.5_03842.1_g00008.1  14 LPPGFRFYPTDEELLVQYLCKKVAGHDFPL-QIIGEIDLYKFDPWVLPSKATFGEKEWYFFSPRDRKYPNGSRPNRVAGTGYWKAT 98 
                              79****************************.89***************988899******************************** PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+dk ++s +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  Sme2.5_03842.1_g00008.1  99 GTDKVITS-QGRKVGIKKALVFYVGKAPKGSKTNWIMHEYRL 139
                              *******9.9999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-6610162IPR003441NAC domain
PROSITE profilePS5100560.26914162IPR003441NAC domain
PfamPF023656.1E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0055114Biological Processoxidation-reduction process
GO:0005634Cellular Componentnucleus
GO:0000721Molecular Function(R,R)-butanediol dehydrogenase activity
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MGVQEKDPLL QLSLPPGFRF YPTDEELLVQ YLCKKVAGHD FPLQIIGEID LYKFDPWVLP  60
SKATFGEKEW YFFSPRDRKY PNGSRPNRVA GTGYWKATGT DKVITSQGRK VGIKKALVFY  120
VGKAPKGSKT NWIMHEYRLF EPSRKNGSAK LDDWVLCRIY KKNSSGLKPL MSGLHSSNEY  180
SHGSSASSSS QFDDMLESLP EMDDRFPNLP RLNSLKTEKL NLERLDSANF DWAILAGLKP  240
MPEAAGIQAQ AQAQVPTHVN HLIHNHNNMN FANDVYAHPT NFRGNAKVES ITFDEEVESG  300
IRNQRADKSG YFQQALGGFS QTYTNGMDQF GIQRPNQTLN LGFRQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-10811684171NO APICAL MERISTEM PROTEIN
1ut4_B1e-10811684171NO APICAL MERISTEM PROTEIN
1ut7_A1e-10811684171NO APICAL MERISTEM PROTEIN
1ut7_B1e-10811684171NO APICAL MERISTEM PROTEIN
3swm_A1e-10811687174NAC domain-containing protein 19
3swm_B1e-10811687174NAC domain-containing protein 19
3swm_C1e-10811687174NAC domain-containing protein 19
3swm_D1e-10811687174NAC domain-containing protein 19
3swp_A1e-10811687174NAC domain-containing protein 19
3swp_B1e-10811687174NAC domain-containing protein 19
3swp_C1e-10811687174NAC domain-containing protein 19
3swp_D1e-10811687174NAC domain-containing protein 19
4dul_A1e-10811684171NAC domain-containing protein 19
4dul_B1e-10811684171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM4352670.0KM435267.1 Solanum melongena NAC gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001233972.10.0jasmonic acid 2
SwissprotQ93VY31e-125NAC72_ARATH; NAC domain-containing protein 72
TrEMBLA0A0A1G3R00.0A0A0A1G3R0_SOLME; NAC
STRINGSolyc12g013620.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31222452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-122NAC family protein